PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN13621.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 312aa    MW: 34478.4 Da    PI: 8.0398
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN13621.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding285.2e-098391748
                     HHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding 17 kqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +++G+g+W++++++ g+ R+ k+c++rw +yl
       KHN13621.1  8 EEHGPGNWRAVPAKTGLSRCSKSCRLRWTNYL 39
                     68****************************97 PP

2Myb_DNA-binding491.4e-154590148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg++T++E++ ++++  +lG++ W++Ia++++  Rt++++k++w+++l
       KHN13621.1 45 RGNFTEQEEKMIIHLQDLLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 90
                     89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007179.2141IPR001005SANT/Myb domain
PROSITE profilePS512947.17139IPR017930Myb domain
CDDcd001671.46E-4839No hitNo description
PfamPF002491.7E-7839IPR001005SANT/Myb domain
SuperFamilySSF466892.86E-22886IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-15846IPR009057Homeodomain-like
PROSITE profilePS5129424.6394094IPR017930Myb domain
SMARTSM007174.0E-154492IPR001005SANT/Myb domain
PfamPF002498.9E-154590IPR001005SANT/Myb domain
CDDcd001678.07E-114790No hitNo description
Gene3DG3DSA:1.10.10.601.4E-244795IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MSRGFEREEH GPGNWRAVPA KTGLSRCSKS CRLRWTNYLR PGIKRGNFTE QEEKMIIHLQ  60
DLLGNRWAAI ASYLPQRTDN DIKNYWNTHL RKKLKKMQVG CEGGSFGEGF SASRQIPRGQ  120
WERRLQTDIQ MAKRALSEAL SPEKPSCNLS ASNSNPSDSS SSFSSTKPTT TQTVCYASSA  180
DNIARMLKGW MKNPPKSSRT NSSSVTQNSF NNFAAAGADT ASSIGAKGPP SSAELSENNF  240
ESLFDFDQSL ESSNSDEFSR SLSPEATVLQ DESKPDVIGA EIMPFSLLEK WLLDEAGCQE  300
KLVGCGDDAK FF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-2089420105MYB PROTO-ONCOGENE PROTEIN
1h88_C5e-2089474159MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-2089474159MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-2089420105C-Myb DNA-Binding Domain
1msf_C1e-2089420105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0937840.0BT093784.1 Soybean clone JCVI-FLGm-24M4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001240154.10.0MYB transcription factor MYB60
SwissprotP813929e-87MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0B2PWB50.0A0A0B2PWB5_GLYSO; Myb-related protein 306
STRINGGLYMA18G49360.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.12e-83myb domain protein 30
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]